AUD
AEDAFNALLAMDANGAOAARSAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
Product Details
How to train your dragon - 2018 Toothless 8"
How to train your dragon - 2018 Toothless 8"
How to train your dragon - 2018 Toothless 8"
How to train your dragon - 2018 Toothless 8"
How to train your dragon - 2018 Toothless 8"
Units in Stock
2
Product Code:3504KOG
Product Condition:Used
$15.00 inc. tax
Add to Cart
Description
Soar into adventure with Toothless, the Night Fury dragon from How to Train Your Dragon! With sleek black scales, piercing green eyes, and wide, poseable wings, this figure captures the stealth and charm of Hiccup’s loyal companion. Perfect for reenacting epic sky battles or displaying as part of your dragon collection.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i